Keratin-38 (KRT38) antibody
| Name | Keratin-38 (KRT38) antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332025 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rabbit |
| Antigen | The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the N-terminal region of Human KRT38. Synthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH. |
| Description | Rabbit Polyclonal |
| Gene | KRT38 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KRT38; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml