Keratin-85 (KRT85) antibody

Name Keratin-85 (KRT85) antibody
Supplier Acris Antibodies
Catalog TA331268
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Antigen The immunogen for Anti-KRT85 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT85. Synthetic peptide located within the following region: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene KRT85
Supplier Page Shop

Product images