KIAA0556 antibody
| Name | KIAA0556 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331962 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-KIAA0556 Antibody is: synthetic peptide directed towards the N-terminal region of Human KIAA0556. Synthetic peptide located within the following region: RTEAGPRLHIEPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVN. |
| Description | Rabbit Polyclonal |
| Gene | KIAA0556 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KIAA0556; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml. KIAA0556 is supported by BioGPS gene expression data to be expressed in NCIH226