Name | KIAA1704 / LSR7 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA344848 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Guinea Pig |
Antigen | The immunogen for anti-KIAA1704 antibody: synthetic peptide directed towards the middle region of human KIAA1704. Synthetic peptide located within the following region: KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | GPALPP1 |
Supplier Page | Shop |