KIAA1704 / LSR7 antibody
| Name | KIAA1704 / LSR7 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344848 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Guinea Pig |
| Antigen | The immunogen for anti-KIAA1704 antibody: synthetic peptide directed towards the middle region of human KIAA1704. Synthetic peptide located within the following region: KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | GPALPP1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-KIAA1704 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Spleen