KIAA1826 antibody
| Name | KIAA1826 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337390 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-MSANTD4 antibody is: synthetic peptide directed towards the N-terminal region of Human MSANTD4. Synthetic peptide located within the following region: QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MSANTD4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MSANTD4; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml