KIAA1841 antibody
| Name | KIAA1841 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337391 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Pig, Rabbit |
| Antigen | The immunogen for Anti-KIAA1841 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA1841. Synthetic peptide located within the following region: NQDAQREDDQRRMTEITGHLIKMRLGDLDRVKSKEAKEFAGGIYSRLEA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KIAA1841 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KIAA1841; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml