KIAA2013 antibody

Name KIAA2013 antibody
Supplier Acris Antibodies
Catalog TA337393
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-KIAA2013 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA2013. Synthetic peptide located within the following region: TDTHTPSGLTVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCF.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene KIAA2013
Supplier Page Shop

Product images