KIF1A antibody
| Name | KIF1A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334686 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Yeast |
| Antigen | The immunogen for anti-KIF1A antibody: synthetic peptide directed towards the N terminal of human KIF1A. Synthetic peptide located within the following region: TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KIF1A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-KIF1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate