KPRP antibody
| Name | KPRP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332250 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-KPRP Antibody is: synthetic peptide directed towards the C-terminal region of Human KPRP. Synthetic peptide located within the following region: PHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAG. |
| Description | Rabbit Polyclonal |
| Gene | KPRP |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KPRP; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml