KRTAP1-5 / KAP1.5 antibody
| Name | KRTAP1-5 / KAP1.5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342999 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Antigen | The immunogen for anti-KRTAP1-5 antibody: synthetic peptide directed towards the C terminal of human KRTAP1-5. Synthetic peptide located within the following region: TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS. |
| Description | Rabbit Polyclonal |
| Gene | KRTAP1-5 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-KRTAP1-5 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain