KRTAP8-1 / KAP8.1 antibody
| Name | KRTAP8-1 / KAP8.1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338958 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Sheep |
| Antigen | The immunogen for anti-KRTAP8-1 antibody: synthetic peptide directed towards the middle region of human KRTAP8-1. Synthetic peptide located within the following region: LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | KRTAP8-1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-KRTAP8-1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart