KRTAP23-1 antibody

Name KRTAP23-1 antibody
Supplier Acris Antibodies
Catalog TA338960
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-KRTAP23-1 antibody: synthetic peptide directed towards the middle region of human KRTAP23-1. Synthetic peptide located within the following region: CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene KRTAP23-1
Supplier Page Shop

Product images