Leiomodin-3 antibody

Name Leiomodin-3 antibody
Supplier Acris Antibodies
Catalog TA337413
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human
Antigen The immunogen for Anti-LMOD3 antibody is: synthetic peptide directed towards the N-terminal region of Human LMOD3. Synthetic peptide located within the following region: VKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETD.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene LMOD3
Supplier Page Shop

Product images