LOC155060 antibody
| Name | LOC155060 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342111 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-LOC155060 antibody: synthetic peptide directed towards the middle region of human LOC155060. Synthetic peptide located within the following region: EVGRPRMMGTGLPPYPEHLTSPLSPAQEELKEGQAPKQQQDSEARVAPAG. |
| Description | Rabbit Polyclonal |
| Gene | LOC155060 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-LOC155060 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: THP-1 cell lysate