LPPR2 antibody
| Name | LPPR2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338613 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-LPPR2 antibody: synthetic peptide directed towards the middle region of human LPPR2. Synthetic peptide located within the following region: NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | LPPR2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-LPPR2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate