LRRC10 antibody
| Name | LRRC10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333330 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Rabbit |
| Antigen | The immunogen for Anti-LRRC10 Antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC10. Synthetic peptide located within the following region: PKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC10 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-LRRC10 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell