LRRC14 antibody
| Name | LRRC14 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335615 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-LRRC14 Antibody is: synthetic peptide directed towards the N-terminal region of Human LRRC14. Synthetic peptide located within the following region: QQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC14 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: LRRC14; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml