LRRC37A3 antibody
| Name | LRRC37A3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335129 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-LRRC37A3 antibody: synthetic peptide directed towards the middle region of human LRRC37A3. Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC37A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-LRRC37A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung