LSM14B antibody
| Name | LSM14B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA340356 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-LSM14B antibody is: synthetic peptide directed towards the N-terminal region of HUMAN LSM14B. Synthetic peptide located within the following region: GPLAASSLLSQQYAASLGLEKLVSPPASAAASSPSSSPSPQPVSELDLSS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LSM14B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: LSM14B; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml