LY6G6D antibody
| Name | LY6G6D antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333724 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-LY6G6D Antibody is: synthetic peptide directed towards the N-terminal region of Human LY6G6D. Synthetic peptide located within the following region: LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LY6G6D |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: LY6G6D; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml