Name | LYSMD2 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330943 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Guinea Pig, Human, Mouse, Pig, Rabbit, Zebrafish |
Antigen | The immunogen for anti-LYSMD2 antibody: synthetic peptide directed towards the middle region of human LYSMD2. Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | LYSMD2 |
Supplier Page | Shop |