LYSMD2 antibody

Name LYSMD2 antibody
Supplier Acris Antibodies
Catalog TA330943
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Guinea Pig, Human, Mouse, Pig, Rabbit, Zebrafish
Antigen The immunogen for anti-LYSMD2 antibody: synthetic peptide directed towards the middle region of human LYSMD2. Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene LYSMD2
Supplier Page Shop

Product images