MACROD2 antibody
| Name | MACROD2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334323 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Pig, Rat |
| Antigen | The immunogen for anti-MACROD2 antibody is: synthetic peptide directed towards the N-terminal region of Human MACROD2. Synthetic peptide located within the following region: LLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MACROD2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MACROD2 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell