MDP1 antibody
| Name | MDP1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA340302 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for anti-MDP-1 antibody: synthetic peptide directed towards the N terminal of human MDP-1. Synthetic peptide located within the following region: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MDP1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MDP-1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate