MED29 antibody
| Name | MED29 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343222 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-Med29 antibody is: synthetic peptide directed towards the middle region of Mouse Med29. Synthetic peptide located within the following region: LQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPD. |
| Description | Rabbit Polyclonal |
| Gene | MED29 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Med29; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml