MESDC1 antibody

Name MESDC1 antibody
Supplier Acris Antibodies
Catalog TA331769
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Rat
Antigen The immunogen for Anti-MESDC1 Antibody is: synthetic peptide directed towards the N-terminal region of Human MESDC1. Synthetic peptide located within the following region: AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA.
Description Rabbit Polyclonal
Gene MESDC1
Supplier Page Shop

Product images