METTL19 antibody

Name METTL19 antibody
Supplier Acris Antibodies
Catalog TA338872
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-C4orf23 antibody: synthetic peptide directed towards the N terminal of human C4orf23. Synthetic peptide located within the following region: LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TRMT44
Supplier Page Shop

Product images