MGC50722 antibody
| Name | MGC50722 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333324 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-MGC50722 Antibody: synthetic peptide directed towards the N terminal of human MGC50722. Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MGC50722 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MGC50722 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate