Mpv17-like protein / MPV17L antibody
| Name | Mpv17-like protein / MPV17L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331414 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human |
| Antigen | The immunogen for anti-MPV17L antibody: synthetic peptide directed towards the N terminal of human MPV17L. Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MPV17L |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MPV17L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate