MRFAP1 antibody
| Name | MRFAP1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337947 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Pig |
| Antigen | The immunogen for anti-MRFAP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MRFAP1. Synthetic peptide located within the following region: KTQVEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVEL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MRFAP1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MRFAP1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart