MRO antibody
| Name | MRO antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342996 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-MRO antibody: synthetic peptide directed towards the C terminal of human MRO. Synthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF. |
| Description | Rabbit Polyclonal |
| Gene | MRO |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MRO Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate