MRPL30 antibody
| Name | MRPL30 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337437 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-MRPL30 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL30. Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MRPL30 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MRPL30; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml