MRPL36 antibody
| Name | MRPL36 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334329 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-MRPL36 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL36. Synthetic peptide located within the following region: PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MRPL36 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MRPL36; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml