MSX3 antibody
| Name | MSX3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342281 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-Msx3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Msx3. Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM. |
| Description | Rabbit Polyclonal |
| Gene | Msx3 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Msx3; Sample Tissue: Rat Lung lysates; Antibody Dilution: 1.0 ug/ml