MTMR10 antibody
| Name | MTMR10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331884 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Guinea Pig, Human, Mouse |
| Antigen | The immunogen for Anti-MTMR10 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR10. Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MTMR10 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MTMR10; Sample Tissue: ACHN whole cell lysates; Antibody Dilution: 1.0ug/ml