MYLC2PL antibody
| Name | MYLC2PL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337450 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-MYL10 antibody is: synthetic peptide directed towards the N-terminal region of Human MYL10. Synthetic peptide located within the following region: ARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | MYL10 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MYL10; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/mlMYL10 is supported by BioGPS gene expression data to be expressed in 721_B