MYPOP / P42POP antibody
| Name | MYPOP / P42POP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330048 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-MYPOP antibody: synthetic peptide directed towards the N terminal of human LOC339344. Synthetic peptide located within the following region: RTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAIL. |
| Description | Rabbit Polyclonal |
| Gene | MYPOP |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MYPOP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate