N4BP2L1 antibody
| Name | N4BP2L1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337454 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the C-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | N4BP2L1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: N4BP2L1; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/mlN4BP2L1 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226