N4BP2L1 antibody

Name N4BP2L1 antibody
Supplier Acris Antibodies
Catalog TA337455
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the N-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: QLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNG.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene N4BP2L1
Supplier Page Shop

Product images