NAGLT1 / KIAA1919 antibody
| Name | NAGLT1 / KIAA1919 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331610 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human |
| Antigen | The immunogen for Anti-KIAA1919 Antibody is: synthetic peptide directed towards the middle region of Human KIAA1919. Synthetic peptide located within the following region: YAVIGTYMFLVSVIFFCLFLKNSSKQEKARASAETFRRAKYHNALLCLLF. |
| Description | Rabbit Polyclonal |
| Gene | KIAA1919 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KIAA1919; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml