NCBP3 antibody

Name NCBP3 antibody
Supplier Acris Antibodies
Catalog TA330681
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-C17orf85 antibody is: synthetic peptide directed towards the C-terminal region of Human C17orf85. Synthetic peptide located within the following region: RLGSAPKTKEKNTKKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSR.
Description Rabbit Polyclonal
Gene C17orf85
Supplier Page Shop

Product images