NDUFC1 antibody
| Name | NDUFC1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337668 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-NDUFC1 antibody: synthetic peptide directed towards the middle region of human NDUFC1. Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | NDUFC1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-NDUFC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver