NECAP2 antibody

Name NECAP2 antibody
Supplier Acris Antibodies
Catalog TA344928
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Human, Mouse, Pig, Rabbit, Zebrafish
Antigen The immunogen for anti-NECAP2 antibody: synthetic peptide directed towards the N terminal of human NECAP2. Synthetic peptide located within the following region: WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene NECAP2
Supplier Page Shop

Product images