NIPA2 antibody
| Name | NIPA2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA336140 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-NIPA2 Antibody: synthetic peptide directed towards the middle region of human NIPA2. Synthetic peptide located within the following region: VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | NIPA2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-NIPA2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate