Noto antibody
| Name | Noto antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341740 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-Noto antibody: synthetic peptide directed towards the n terminal of mouse Noto. Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP. |
| Description | Rabbit Polyclonal |
| Gene | NOTO |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Noto Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Brain