| Name | NSUN5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331632 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-NSUN5 Antibody is: synthetic peptide directed towards the C-terminal region of Human NSUN5. Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA. |
| Description | Rabbit Polyclonal |
| Gene | NSUN5 |
| Supplier Page | Shop |