NT5DC3 antibody
| Name | NT5DC3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330652 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-NT5DC3 antibody is: synthetic peptide directed towards the C-terminal region of Human NT5DC3. Synthetic peptide located within the following region: GLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQNP. |
| Description | Rabbit Polyclonal |
| Gene | NT5DC3 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: NT5DC3; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml