NUDT14 / UGPP antibody
| Name | NUDT14 / UGPP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331573 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-NUDT14 Antibody is: synthetic peptide directed towards the middle region of Human NUDT14. Synthetic peptide located within the following region: SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK. |
| Description | Rabbit Polyclonal |
| Gene | NUDT14 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: NUDT14; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml