ODF3L1 antibody
| Name | ODF3L1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337559 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Rat |
| Antigen | The immunogen for anti-ODF3L1 antibody: synthetic peptide directed towards the N terminal of human ODF3L1. Synthetic peptide located within the following region: KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ODF3L1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ODF3L1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta