Olfactory receptor 9I1 antibody
| Name | Olfactory receptor 9I1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332289 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-OR9I1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9I1. Synthetic peptide located within the following region: VKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVF. |
| Description | Rabbit Polyclonal |
| Gene | OR9I1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR9I1; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml