OR1K1 antibody
| Name | OR1K1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337480 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human |
| Antigen | The immunogen for Anti-OR1K1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1K1. Synthetic peptide located within the following region: CGSHLAVVSLFYGTVIAVYFQATSRREAEWGRVATVMYTVVTPMLNPIIY. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | OR1K1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR1K1; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml